Goat Polyclonal Antibody against DCTN1
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QEQLHQLHSRLIS, from the C Terminus of the protein sequence according to NP_004073; NP_075408. |
Goat Polyclonal Antibody against DCTN1
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QEQLHQLHSRLIS, from the C Terminus of the protein sequence according to NP_004073; NP_075408. |
Rabbit polyclonal antibody to dynactin 1 (dynactin 1 (p150, glued homolog, Drosophila))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1216 and 1278 of DCTN1 (Uniprot ID#Q14203) |
Rabbit anti-DCTN1 Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DCTN1 |
Rabbit Polyclonal Anti-Dctn1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Dctn1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Dctn1. Synthetic peptide located within the following region: EANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQTLLRKKEKEFEETMD |
DCTN1 (C-term) goat polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-DCTN1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DCTN1 |
DCTN1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DCTN1 |