Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-EWSR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the middle region of human EWSR1. Synthetic peptide located within the following region: QPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQS

Rabbit polyclonal anti-EWSR1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EWSR1.

Rabbit polyclonal EWSR1 Antibody (C-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EWSR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 628-656 amino acids from the C-terminal region of human EWSR1.

Rabbit polyclonal EWSR1 Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EWSR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 623-652 amino acids from the C-terminal region of human EWSR1.

Goat Anti-EWS / EWSR1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TSYDQSSYSQQNTYG, from the internal region of the protein sequence according to NP_053733.1; NP_005234.1.

Anti-EWSR1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.213~217(T-Y-G-Q-P)derived from Human EWS.

Rabbit Polyclonal Anti-EWSR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the middle region of human EWSR1. Synthetic peptide located within the following region: RGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY

Rabbit anti EWSR Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal segment of EWSR1 protein. This sequence is identical among human, rat, mouse and dog species.

EWSR1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human EWSR1

EWSR1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human EWSR1

EWSR1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-300 of human EWSR1 (NP_001156757.1).
Modifications Unmodified