Primary Antibodies

View as table Download

Rabbit polyclonal anti-HLX1 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HLX1.

Rabbit Polyclonal Anti-HLX Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLX antibody: synthetic peptide directed towards the middle region of human HLX. Synthetic peptide located within the following region: WFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGAPAADGEQDERSPSRSEG

Rabbit Polyclonal Anti-HLX Antibody

Applications IF, WB
Reactivities Human, Xenopus
Conjugation Unconjugated
Immunogen The immunogen for anti-HLX1 antibody: synthetic peptide directed towards the middle region of human HLX1 (Cat# AAP31195). Synthetic peptide located within the following region: PGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDR

HLX Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-280 of human HLX (NP_068777.1).
Modifications Unmodified

HLX Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-280 of human HLX (NP_068777.1).
Modifications Unmodified