Rabbit Polyclonal Anti-SGOL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SGOL1 Antibody: A synthesized peptide derived from human SGOL1 |
Rabbit Polyclonal Anti-SGOL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SGOL1 Antibody: A synthesized peptide derived from human SGOL1 |
Rabbit polyclonal anti-SGOL1 (QORX) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human QORX. |
Rabbit polyclonal anti-SGOL1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SGOL1. |
Rabbit Polyclonal Anti-SGOL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SGOL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SGOL1. Synthetic peptide located within the following region: NSDRPVTRPLAKRALKYTDEKETEGSKPTKTPTTTPPETQQSPHLSLKDI |