Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-VARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS antibody: synthetic peptide directed towards the middle region of human VARS. Synthetic peptide located within the following region: VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP

Rabbit Polyclonal Anti-EARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EARS2 antibody: synthetic peptide directed towards the middle region of human EARS2. Synthetic peptide located within the following region: TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL

Rabbit Polyclonal Anti-WARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WARS2 antibody: synthetic peptide directed towards the middle region of human WARS2. Synthetic peptide located within the following region: TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG

Rabbit Polyclonal Anti-VARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS2 antibody: synthetic peptide directed towards the middle region of human VARS2. Synthetic peptide located within the following region: LERRFSRVQEVVQVLRALRATYQLTKARPRVLLQSSEPGDQGLFEAFLEP

Rabbit Polyclonal Anti-HARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HARS antibody: synthetic peptide directed towards the N terminal of human HARS. Synthetic peptide located within the following region: FVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETL

Rabbit Polyclonal Anti-TARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TARS2 antibody is: synthetic peptide directed towards the C-terminal region of Human TARS2. Synthetic peptide located within the following region: VVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHY

Anti-AARS rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to N terminal 14 amino acids of human alanyl-tRNA synthetase

Anti-AARS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to N terminal 14 amino acids of human alanyl-tRNA synthetase

Anti-AARS2 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 686-985 amino acids of human alanyl-tRNA synthetase 2, mitochondrial

Anti-AARS2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 686-985 amino acids of human alanyl-tRNA synthetase 2, mitochondrial

Rabbit Polyclonal Anti-FARSB Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FARSB

Rabbit Polyclonal Anti-YARS2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human YARS2

Rabbit Polyclonal Anti-KARS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KARS

FARS2 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FARS2

NARS Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

SARS2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

IARS2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

RARS Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated