Germany
Japan
United Kingdom
China
AIRE Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AIRE |
Primary Antibodies
View as table Download
AIRE Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AIRE |
AIRE Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AIRE |
AIRE Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AIRE |
IL7R Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IL7R |
RAG2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
AICDA Antibody N-terminal region
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT |
TNFRSF13C Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNFRSF13B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Clonalities
- Polyclonal
Pathways
- Primary immunodeficiency
Filter by
Category
Target Symbol
- LCK (20)
- IKBKG (19)
- AIRE (15)
- ZAP70 (15)
- CD19 (10)
- BTK (9)
- BLNK (8)
- CD40 (8)
- PTPRC (8)
- CD4 (7)
- UNG (7)
- ADA (6)
- CD40LG (6)
- CIITA (6)
- DCLRE1C (5)
- TNFRSF13B (5)
- AICDA (4)
- CD3D (4)
- CD3E (4)
- CD79A (4)
- CD8A (4)
- CD8B (4)
- IL2RG (4)
- JAK3 (4)
- TAP2 (4)
- IL7R (3)
- RAG2 (3)
- RFX5 (3)
- TNFRSF13C (3)
- ICOS (2)
- IGLL1 (2)
- RFXANK (2)
- RFXAP (2)
- TAP1 (2)