Primary Antibodies

View as table Download

Rabbit anti-PDE1B Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PDE1B

PDE1B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 473-500 amino acids from the C-terminal region of Human PDE1B

PDE1B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 466-495 amino acids from the C-terminal region of human PDE1B

Anti-PDE1B Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 190-536 amino acids of human phosphodiesterase 1B, calmodulin-dependent

Rabbit Polyclonal Anti-PDE1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE1B antibody: synthetic peptide directed towards the middle region of human PDE1B. Synthetic peptide located within the following region: VKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNL