Primary Antibodies

View as table Download

Rabbit anti-ETS1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of human ETS1

ETS1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 46-74 amino acids from the N-terminal region of Human ETS1

Rabbit Polyclonal Anti-ETS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ETS1 antibody: synthetic peptide directed towards the N terminal of human ETS1. Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN

Anti-ETS1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 209 amino acids of human v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)

Rabbit Polyclonal anti-ETS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ETS1 antibody is: synthetic peptide directed towards the middle region of Human ETS1. Synthetic peptide located within the following region: FQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNG