Primary Antibodies

View as table Download

Rabbit polyclonal Anti-KCa1.1 (BKCa) (extracellular)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DSSNPIES(S)QNFYKD, corresponding to amino acid residues 199-213 of rat KCa1.1 . 1st extracellular loop.

Rabbit polyclonal Anti-KCa1.1 (1184-1200)

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)STANRPNRPKSRESRDK, corresponding to amino acid residues 1184-1200 of mouse KCa1.1. Intracellular, C-terminal part.

Rabbit Polyclonal Anti-KCNMA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the c terminal region of human KCNMA1. Synthetic peptide located within the following region: CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG

KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Dog, Pig
Conjugation Unconjugated
Immunogen KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Dog, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%).

KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse
Conjugation Unconjugated
Immunogen KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%).

Rabbit polyclonal Anti-KCNMA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the middle region of human KCNMA1. Synthetic peptide located within the following region: ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD

Rabbit Polyclonal Anti-KCNMA1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human KCNMA1

KCNMA1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human KCNMA1