Primary Antibodies

Jump to Filters
View as table Download
NLRX1 Rabbit Polyclonal Antibody
TA320016

USD 430.00

In Stock

Rabbit Polyclonal NOD5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NOD5 antibody was raised against a 14 amino acid synthetic peptide near the amino terminus of human NOD5.
NLRX1 Rabbit Polyclonal Antibody
TA337151

USD 424.00

5 Days

Rabbit Polyclonal NLRX1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Equine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 580-630 of human NLRX1 was used as the immunogen for the antibody.
NLRX1 Rabbit Polyclonal Antibody
TA337810

USD 375.00

5 Days

Rabbit Polyclonal Anti-NLRX1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRX1 antibody is: synthetic peptide directed towards the N-terminal region of Human NLRX1. Synthetic peptide located within the following region: GSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQ
NLRX1 Rabbit Polyclonal Antibody
TA379171

USD 220.00

3 Weeks

NLRX1 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 87-360 of human NLRX1 (NP_001269073.1).
Modifications Unmodified