Primary Antibodies

Jump to Filters
View as table Download
LOC102723996 (C-term) Rabbit Polyclonal Antibody
AP52143PU-N

USD 450.00

2 Weeks

LOC102723996 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 216-246 amino acids from the C-terminal region of human CD275 / ICOS Ligand
ICOS Ligand (ICOSLG) Rabbit Polyclonal Antibody
TA343354

USD 375.00

5 Days

Rabbit Polyclonal Anti-ICOSLG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ICOSLG antibody is: synthetic peptide directed towards the N-terminal region of Human ICOSLG. Synthetic peptide located within the following region: VDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEV
ICOS Ligand (ICOSLG) Rabbit Polyclonal Antibody
TA321838

USD 345.00

In Stock

Anti-ICOSLG Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 70-84 amino acids of human inducible T-cell co-stimulator ligand
ICOS Ligand (ICOSLG) Rabbit Polyclonal Antibody
TA350632

USD 345.00

In Stock

Rabbit Polyclonal Anti-ICOSLG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ICOSLG
ICOS Ligand (ICOSLG) Rabbit Polyclonal Antibody
TA377315

USD 220.00

3 Weeks

ICOSL Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-256 of human ICOSL (NP_056074.1).
Modifications Unmodified