Primary Antibodies

View as table Download

AGAP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human AGAP2

Rabbit Polyclonal Anti-AGAP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human AGAP2

Rabbit Polyclonal PIKE Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen PIKE antibody was raised against a peptide corresponding to 15 amino acids near the C-terminus of human PIKE.

Centaurin gamma 1 (AGAP2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 850-877 amino acids from the C-terminal region of human CENTG1

Goat Anti-CENTG1 / PIKE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QASLDSIREAVINSQ, from the internal region of the protein sequence according to NP_055585.1.

Rabbit polyclonal anti-AGAP2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to amino acids 1-836 of human AGAP2 protein.

Rabbit Polyclonal Anti-CENTG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CENTG1 antibody: synthetic peptide directed towards the middle region of human CENTG1. Synthetic peptide located within the following region: AHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQG