Primary Antibodies

View as table Download

Collagen VI (COL6A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Bovine, Chicken, Human, Mouse, Porcine, Rat
Immunogen Purified collagen type VI from human placenta.

Collagen VI (COL6A1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Bovine, Human

Collagen VI (COL6A1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mammalian
Immunogen Collagen type VI purified from Human and Bovine placenta.

Collagen VI (COL6A1) rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mammalian
Conjugation Biotin
Immunogen Collagen type VI purified from Human and Bovine placenta.

Collagen VI (COL6A1) goat polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen
Human type VI collagen. Antiserum to human type VI collagen was raised by repeated immunisation of goats with highly purified antigen.

Collagen VI (COL6A1) goat polyclonal antibody, Azide Free

Applications ELISA, IF, IHC
Reactivities Human
Immunogen Collagen VI antibody was raised against Human type VI Collagen.

Collagen VI (COL6A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Bovine, Chicken, Human, Mouse, Porcine, Rat
Immunogen Purified collagen type VI from human placenta.

Collagen VI (COL6A1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mammalian
Immunogen Collagen type VI purified from Human and Bovine placenta.

Collagen VI (COL6A1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated

Collagen VI (COL6A1) alpha 1 chain rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human COL6A1

Collagen VI (COL6A1) alpha 1 chain rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human COL6A1

Rabbit Polyclonal Anti-COL6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COL6A1 antibody: synthetic peptide directed towards the middle region of human COL6A1. Synthetic peptide located within the following region: ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ

Collagen VI/COL6A1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-250 of human Collagen VI/Collagen VI/COL6A1 (NP_001839.2).
Modifications Unmodified