Primary Antibodies

View as table Download

Goat Polyclonal Anti-PRDM1 / MEL1 Antibody

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-PRDM1 / MEL1 Antibody: Peptide with sequence C-DISDNADRLEDVED, from the internal region of the protein sequence according to NP_001189.2; NP_878911.1.

Rabbit Polyclonal Anti-Blimp-1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Blimp-1 Antibody: Peptide sequence around aa.124~128(D-T-V-P-K) derived from Human Blimp-1

PRDM1 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rat
Immunogen Peptide with sequence C-KVKQETVEPMDP, from the C-Terminus of the protein sequence according to NP_001189.2; NP_878911.1.

Rabbit Polyclonal Blimp-1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PEN2 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human PEN2.

Rabbit Polyclonal Blimp-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Blimp-1 antibody was raised against a 17 amino acid peptide from near the amino terminus of human Blimp-1.

Rabbit Polyclonal Anti-PRDM1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDM1 antibody: synthetic peptide directed towards the middle region of human PRDM1. Synthetic peptide located within the following region: VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES

Rabbit polyclonal PRDM1 BLIMP1 antibody

Applications WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the C-terminus of human, mouse, and rat PRDM1/BLIMP1.

Rabbit polyclonal PRDM1 Antibody (N-term)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This PRDM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 106-134 amino acids from the N-terminal region of human PRDM1.

Rabbit Polyclonal Anti-PRDM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDM1 antibody: synthetic peptide directed towards the N terminal of human PRDM1. Synthetic peptide located within the following region: MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRN

PRDM1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human PRDM1 (NP_878911.1).
Modifications Unmodified