Primary Antibodies

View as table Download

Rabbit anti-SUMO3 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human SUMO3

Rabbit Polyclonal Anti-SUMO3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUMO3 antibody: synthetic peptide directed towards the middle region of human SUMO3. Synthetic peptide located within the following region: MRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF

Rabbit Polyclonal SUMO3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SUMO3 antibody was raised against a 13 amino acid synthetic peptide near the carboxy terminus of human SUMO3.

Rabbit polyclonal Pan SUMO Antibody

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This Pan SUMO antibody recognizes all 3 SUMO isoforms, including human SUMO1, SUMO2 and SUMO3. This antibody is generated from rabbits immunized with a recombinant protein encoding full length human SUMO3.

Rabbit polyclonal anti-SUMO-3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from rabbit serum after repeated immunizations with recombinant human SUMO-3 protein.

Rabbit Polyclonal SUMO3 Antibody

Applications WB
Reactivities Equine, Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 50-95 of human SUMO3 (SMT3) was used as the immunogen for this antibody.

Rabbit anti SUMO-3/Sentrin-3 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide derived from C-terminus of human Sentrin-3 protein. This sequence is identical to human, mouse and rat.