Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-K2P3.1 (TASK-1)

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide (C)EDEKRDAEHRALLTRNGQ, corresponding to amino acid residues 252-269 of human K2P3.1 (TASK-1). Intracellular, C-terminal part.

Rabbit Polyclonal Anti-KCNK3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK3 antibody: synthetic peptide directed towards the C terminal of human KCNK3. Synthetic peptide located within the following region: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL

Rabbit Polyclonal Anti-KCNK3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNK3