Primary Antibodies

View as table Download

Rabbit polyclonal YB1 (Ser102) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human YB1 around the phosphorylation site of serine 102 (L-R-SP-V-G).
Modifications Phospho-specific

Rabbit Polyclonal YB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the entire range of the protein (CAA65446).

Rabbit polyclonal YBX1 Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This YBX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 149-178 amino acids from the Central region of human YBX1.

Rabbit polyclonal YBX1 Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This YBX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 276-305 amino acids from the C-terminal region of human YBX1.

Rabbit Polyclonal Anti-YBX1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-YBX1 Antibody: synthetic peptide directed towards the middle region of human YBX1. Synthetic peptide located within the following region: NHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRR

Rabbit Polyclonal Anti-NSEP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NSEP1 Antibody: synthetic peptide directed towards the C terminal of human NSEP1. Synthetic peptide located within the following region: NMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNF

Rabbit Polyclonal Anti-YBX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-YBX1 antibody is: synthetic peptide directed towards the C-terminal region of Human YBX1. Synthetic peptide located within the following region: PYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPP

Carrier-free (BSA/glycerol-free) YBX1 mouse monoclonal antibody, clone OTI7B4 (formerly 7B4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) YBX1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) YBX1 mouse monoclonal antibody, clone OTI11A7 (formerly 11A7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-YBX1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 310-324 amino acids of human Y box binding protein 1

Anti-YBX1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 310-324 amino acids of human Y box binding protein 1

YBX1 mouse monoclonal antibody, clone OTI7B4 (formerly 7B4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

YBX1 mouse monoclonal antibody, clone OTI7B4 (formerly 7B4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

YBX1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

YBX1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

YBX1 mouse monoclonal antibody, clone OTI11A7 (formerly 11A7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

YBX1 mouse monoclonal antibody, clone OTI11A7 (formerly 11A7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated