YB1 (YBX1) Rabbit Polyclonal Antibody

CAT#: TA339853

Rabbit Polyclonal Anti-YBX1 Antibody

Product Images

Host: Rabbit; Target Name: YBX1; Sample Tissue: Thymus Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-YBX1 antibody is: synthetic peptide directed towards the C-terminal region of Human YBX1. Synthetic peptide located within the following region: PYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: Y-box binding protein 1
• Database Link:
  NP_004550
  Entrez Gene 4904 Human
  UniProt ID P67809
• Background: YBX1 binds to splice sites in pre-mRNA and regulates splice site selection. YBX1 binds and stabilizes cytoplasmic mRNA. YBX1 contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors. YBX1 binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as HLA class II genes. YBX1 regulates the transcription of numerous genes. YBX1 promotes separation of DNA strands that contain mismatches or are modified by cisplatin. YBX1 has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA (in vitro). YBX1 may play a role in DNA repair. YBX1 is the component of the CRD-mediated complex that promotes MYC mRNA stability.
• Synonyms: BP-8; CSDA2; CSDB; DBPB; MDR-NF1; NSEP-1; NSEP1; YB-1; YB1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Human: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Transcription Factors