Primary Antibodies

View as table Download

Rabbit Polyclonal TSLP Receptor Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TSLP Receptor antibody was raised against a 19 amino acid peptide from near the center of human TSLP receptor.

Mouse Polyclonal TSLP R/CRLF2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Amino acids 119-231 of human TSLPR protein were used as the immunogen for the antibody.

Mouse Polyclonal TSLP R/CRLF2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Amino acids 119-231 of human TSLPR protein were used as the immunogen for the antibody.

Mouse Monoclonal TSLP R/CRLF2 Antibody (59N5G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-CRLF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRLF2 Antibody: synthetic peptide directed towards the middle region of human CRLF2. Synthetic peptide located within the following region: FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF

Rabbit Polyclonal Anti-CRLF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRLF2