Rabbit Polyclonal TSLP Receptor Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TSLP Receptor antibody was raised against a 19 amino acid peptide from near the center of human TSLP receptor. |
Rabbit Polyclonal TSLP Receptor Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TSLP Receptor antibody was raised against a 19 amino acid peptide from near the center of human TSLP receptor. |
Rabbit Polyclonal TSLP Receptor Antibody
Applications | IF, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | TSLP receptor antibody was raised against a 21 amino acid peptide from near the center of mouse TSLP receptor. |
Rabbit Polyclonal Anti-CRLF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CRLF2 Antibody: synthetic peptide directed towards the middle region of human CRLF2. Synthetic peptide located within the following region: FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF |
Rabbit Polyclonal Anti-CRLF2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CRLF2 |
CRLF2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CRLF2 |
CRLF2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-231 of human CRLF2 (NP_071431.2). |
Modifications | Unmodified |