Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-HINT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HINT1 antibody: synthetic peptide directed towards the N terminal of human HINT1. Synthetic peptide located within the following region: ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTH |
Rabbit Polyclonal Anti-HINT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HINT1 antibody: synthetic peptide directed towards the N terminal of human HINT1. Synthetic peptide located within the following region: CLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAAD |
HINT1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human HINT1 (NP_005331.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HINT1
Isotypes
- IgG
Conjugates
- Unconjugated