Primary Antibodies

Jump to Filters
View as table Download
Glutathione Reductase (GSR) Rabbit Polyclonal Antibody
TA336225

USD 375.00

5 Days

Rabbit Polyclonal Anti-GSR Antibody

Applications IF, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP
Glutathione Reductase (GSR) Rabbit Polyclonal Antibody
TA323576

USD 345.00

In Stock

Anti-GSR Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 274-475 amino acids of human glutathione reductase
Glutathione Reductase (GSR) Rabbit Polyclonal Antibody
TA323577

USD 345.00

In Stock

Anti-GSR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 274-475 amino acids of human glutathione reductase