Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PCBP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCBP1 antibody is: synthetic peptide directed towards the middle region of Human PCBP1. Synthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF

Rabbit Polyclonal Anti-PCBP1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PCBP1 antibody: synthetic peptide directed towards the middle region of human PCBP1. Synthetic peptide located within the following region: CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM

Goat Anti-PCBP1 (aa223-234) Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-SIQGQHTISPLD, from the internal region of the protein sequence according to NP_006187.2.

Goat Anti-PCBP1 (aa234-247) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ADLAKLNQVARQQSH, from the internal region of the protein sequence according to CAA55016.1.

Carrier-free (BSA/glycerol-free) PCBP1 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PCBP1 mouse monoclonal antibody, clone OTI10B7 (formerly 10B7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PCBP1 mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PCBP1 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PCBP1 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PCBP1 mouse monoclonal antibody, clone OTI10B7 (formerly 10B7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PCBP1 mouse monoclonal antibody, clone OTI10B7 (formerly 10B7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PCBP1 mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PCBP1 mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated