Goat Polyclonal Antibody against SERPINE1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GFKIDDKGMAPALRH, from the internal region of the protein sequence according to NP_000593.1. |
Goat Polyclonal Antibody against SERPINE1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GFKIDDKGMAPALRH, from the internal region of the protein sequence according to NP_000593.1. |
Rabbit polyclonal SERPINE1 Antibody (Center)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SERPINE1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-216 amino acids from the Central region of human SERPINE1. |
Rabbit Polyclonal Serpin E1/PAI-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human PAI1/Serpine 1 protein (between residues 300-400) [UniProt P05121] |
Rabbit Polyclonal Anti-SERPINE1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SERPINE1 antibody: synthetic peptide directed towards the C terminal of human SERPINE1. Synthetic peptide located within the following region: VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM |
Anti-Human PAI-1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human PAI-1 |
Rabbit Polyclonal Anti-SERPINE1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SERPINE1 antibody: synthetic peptide directed towards the N terminal of human SERPINE1. Synthetic peptide located within the following region: VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ |
Anti-SERPINE1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 24-324 amino acids of human serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 |