Primary Antibodies

View as table Download

Rabbit anti-PPP1CA Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP1CA

Anti-PPP1CA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-PPP1CA Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppp1ca antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ppp1ca. Synthetic peptide located within the following region: RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFS

Carrier-free (BSA/glycerol-free) PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP1CA Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human PPP1CA (NP_002699.1).
Modifications Unmodified

Phospho-PPP1CA-T320 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T320 of human PPP1CA
Modifications Phospho T320

PP1C alpha/beta Rabbit monoclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated