Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to CSE1L (CSE1 chromosome segregation 1-like (yeast))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 222 and 469 of CSE1L (Uniprot ID#P55060)

Rabbit polyclonal anti-CSE1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CSE1.

Rabbit Polyclonal Anti-CSE1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSE1L antibody: synthetic peptide directed towards the N terminal of human CSE1L. Synthetic peptide located within the following region: ELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLE

Carrier-free (BSA/glycerol-free) CSE1L mouse monoclonal antibody,clone OTI4G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Exportin 2 (XPO2) Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Exportin 2 (XPO2) (NP_001243064.1).
Modifications Unmodified