Rabbit Polyclonal Anti-MPO Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MPO |
Rabbit Polyclonal Anti-MPO Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MPO |
Rabbit Polyclonal Anti-MPO Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MPO antibody: synthetic peptide directed towards the N terminal of human MPO. Synthetic peptide located within the following region: QLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVR |
Rabbit polyclonal anti-Myeloperoxidase (MPO) antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 765 of human MPO |
Rabbit polyclonal Myeloperoxidase antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Myeloperoxidase [Human Leukocytes] |
Rabbit Polyclonal Myeloperoxidase Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
MPO Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse MPO |
Myeloperoxidase (MPO) Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-310 of human Myeloperoxidase (MPO) (NP_000241.1). |
Modifications | Unmodified |
USD 447.00
2 Weeks
MPO mouse monoclonal antibody, clone OTI4G10
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
USD 447.00
2 Weeks
MPO biotinylated mouse monoclonal antibody, clone OTI4B1
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |