Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MYL9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYL9 antibody: synthetic peptide directed towards the middle region of human MYL9. Synthetic peptide located within the following region: FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF

Rabbit polyclonal anti-Myosin antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 12-27 of human myosin light chain protein.

Carrier-free (BSA/glycerol-free) MYL9 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-MYL9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human myosin, light chain 9, regulatory

Anti-MYL9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human myosin, light chain 9, regulatory

MYL9 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYL9 (NP_006088.2).
Modifications Unmodified

Phospho-MYL9-S19 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S19 of human Phospho-MYL9-S19 (NP_006088.2).
Modifications Phospho S19

Phospho-MYL9-T18/S19 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around of human Phospho-MYL9-T18/S19 .
Modifications Phospho T18/S19

MYL9 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MYL9 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated