Primary Antibodies

View as table Download

Mouse Monoclonal anti-RHO Antibody

Applications IF
Reactivities Bovine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated

Rabbit polyclonal anti-RHO (rhodopsin) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human RHO.

Mouse Monoclonal anti-RHO Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse Anti-Rhodopsin Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-RHO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHO antibody: synthetic peptide directed towards the C terminal of human RHO. Synthetic peptide located within the following region: AFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTE

Rhodopsin Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human Rhodopsindopsin (NP_000530.1).
Modifications Unmodified

Recombinant Anti-Rhodopsin (Clone Rho 1D4)

Applications ELISA, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Zebrafish, Cow
Conjugation Unconjugated
Modifications This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-Rhodopsin (Clone Rho 1D4)

Applications ELISA, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Zebrafish, Cow
Conjugation Unconjugated