Mouse Monoclonal Rictor Antibody (7B3)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
TA336802 is a replacement of AM06499SU-N.
Mouse Monoclonal Rictor Antibody (7B3)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to RICTOR
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1648 and 1708 of RICTOR (Uniprot ID#Q6R327) |
Rabbit polyclonal anti-Rictor antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 1639 of mouse Rictor |
Goat Polyclonal Antibody against RICTOR
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KQPIVDTSAES, from the C Terminus of the protein sequence according to NP_689969.2. |
Rabbit Polyclonal Anti-RICTOR Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RICTOR |
RICTOR Antibody
Applications | IHC |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence GENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSG |
RICTOR rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RICTOR |
RICTOR Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human RICTOR (NP_689969.2). |
Modifications | Unmodified |