Primary Antibodies

View as table Download

SEMA7A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SEMA7A

Rabbit Polyclonal Anti-SEMA7A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SEMA7A

Rabbit Polyclonal Anti-SEMA7A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEMA7A antibody is: synthetic peptide directed towards the C-terminal region of Human SEMA7A. Synthetic peptide located within the following region: SIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPME

Rabbit polyclonal anti-SEMA7A antibody (N-term)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SEMA7A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-202 amino acids from the N-terminal region of human SEMA7A.

SEMA7A Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 45-280 of human SEMA7A (NP_003603.1).
Modifications Unmodified