Xanthine Oxidase (XDH) guinea pig polyclonal antibody, Serum
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Xanthine Oxidase purified from Bovine Milk Fat Globule Membrane (MFGM). |
Xanthine Oxidase (XDH) guinea pig polyclonal antibody, Serum
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Xanthine Oxidase purified from Bovine Milk Fat Globule Membrane (MFGM). |
Xanthine Oxidase (XDH) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 213~242 amino acids from the N-terminal region of human XDH |
Rabbit Polyclonal Anti-XDH Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Xdh antibody is: synthetic peptide directed towards the N-terminal region of Rat Xdh. Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS |
Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI5D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI1C10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
XDH mouse monoclonal antibody,clone OTI5D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI5D8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI5D8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
XDH mouse monoclonal antibody,clone OTI5D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
XDH mouse monoclonal antibody,clone OTI1C10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI1C10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI1C10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
XDH mouse monoclonal antibody,clone OTI1C10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".