Primary Antibodies

View as table Download

Xanthine Oxidase (XDH) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Xanthine Oxidase purified from Bovine Milk Fat Globule Membrane (MFGM).

Xanthine Oxidase (XDH) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 213~242 amino acids from the N-terminal region of human XDH

Rabbit Polyclonal Anti-XDH Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Xdh antibody is: synthetic peptide directed towards the N-terminal region of Rat Xdh. Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS

Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI5D8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI1C10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

XDH mouse monoclonal antibody,clone OTI5D8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

XDH mouse monoclonal antibody,clone OTI1C10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated