Primary Antibodies

View as table Download

Rabbit polyclonal antibody to SH3GL1 (SH3-domain GRB2-like 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 152 and 368 of EEN (Uniprot ID#Q99961)

Rabbit polyclonal Anti-SH3GL1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3GL1 antibody: synthetic peptide directed towards the N terminal of human SH3GL1. Synthetic peptide located within the following region: LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES

Carrier-free (BSA/glycerol-free) SH3GL1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SH3GL1 mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SH3GL1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SH3GL1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

SH3GL1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

SH3GL1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SH3GL1 mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SH3GL1 mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

SH3GL1 mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

SH3GL1 mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated