Rabbit anti-HEXA Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HEXA |
Rabbit anti-HEXA Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HEXA |
Rabbit polyclonal anti-HEXB antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human HEXB. |
Rabbit Polyclonal Anti-GLA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GLA Antibody: synthetic peptide directed towards the N terminal of human GLA. Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF |
Rabbit Polyclonal Anti-A4GALT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-A4GALT antibody: synthetic peptide directed towards the middle region of human A4GALT. Synthetic peptide located within the following region: RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE |
USD 375.00
5 Days
Rabbit Polyclonal Anti-FUT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FUT1 antibody: synthetic peptide directed towards the middle region of human FUT1. Synthetic peptide located within the following region: EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFL |
Rabbit Polyclonal Anti-A4GALT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-A4GALT antibody: synthetic peptide directed towards the middle region of human A4GALT. Synthetic peptide located within the following region: VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI |
Rabbit Polyclonal Anti-HEXA Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV |
Rabbit Polyclonal Anti-NAGA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NAGA antibody is: synthetic peptide directed towards the N-terminal region of NAGA. Synthetic peptide located within the following region: GYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYA |
Rabbit Polyclonal Anti-NAGA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NAGA antibody is: synthetic peptide directed towards the middle region of Human NAGA. Synthetic peptide located within the following region: CFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLAD |
Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI6F3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI7F1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI8H7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI3A4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-A4GALT Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human A4GALT |
USD 345.00
4 Weeks
Rabbit Polyclonal Anti-FUT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FUT1 |
NAGA mouse monoclonal antibody,clone OTI6F3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NAGA mouse monoclonal antibody,clone OTI6F3, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
NAGA mouse monoclonal antibody,clone OTI6F3, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
NAGA mouse monoclonal antibody,clone OTI6F3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NAGA mouse monoclonal antibody,clone OTI7F1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NAGA mouse monoclonal antibody,clone OTI7F1, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
NAGA mouse monoclonal antibody,clone OTI7F1, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
NAGA mouse monoclonal antibody,clone OTI7F1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NAGA mouse monoclonal antibody,clone OTI8H7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NAGA mouse monoclonal antibody,clone OTI8H7, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
NAGA mouse monoclonal antibody,clone OTI8H7, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
NAGA mouse monoclonal antibody,clone OTI8H7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NAGA mouse monoclonal antibody,clone OTI3A4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NAGA mouse monoclonal antibody,clone OTI3A4, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
NAGA mouse monoclonal antibody,clone OTI3A4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
NAGA mouse monoclonal antibody,clone OTI3A4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |