Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NP antibody: synthetic peptide directed towards the middle region of human NP. Synthetic peptide located within the following region: GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG

NAMPT Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NAMPT

Rabbit Polyclonal Anti-PBEF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PBEF1 antibody: synthetic peptide directed towards the C terminal of human PBEF1. Synthetic peptide located within the following region: VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH

CD38 mouse monoclonal antibody, clone T16, Aff - Purified

Applications FC, IF, IHC
Reactivities Human

Rabbit polyclonal CD38 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38.

CD38 mouse monoclonal antibody, clone T16, PE

Applications FC, IF
Reactivities Human
Conjugation PE

Rabbit polyclonal anti-AOX1 antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AOX1.

Rabbit anti-PNP Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PNP

Rabbit Polyclonal Anti-PBEF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PBEF1 antibody: synthetic peptide directed towards the C terminal of human PBEF1. Synthetic peptide located within the following region: CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL

ENPP3 mouse monoclonal antibody, clone NP4D6, Aff - Purified

Applications FC, IF, IHC
Reactivities Human

CD38 mouse monoclonal antibody, clone T16, APC

Applications FC, IF
Reactivities Human
Conjugation APC

Visfatin (NAMPT) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Highly pure E.coli derived recombinant Human Visfatin.

Visfatin (NAMPT) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Highly pure E.coli derived recombinant Human Visfatin.

Goat Anti-ENPP1 / PC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KTHLPTFSQED, from the C Terminus of the protein sequence according to NP_006199.2.

Anti-Human Visfatin Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Visfatin

ENPP3 mouse monoclonal antibody, clone NP4D6, PE

Applications FC, IF
Reactivities Human
Conjugation PE

CD38 mouse monoclonal antibody, clone T16, PerCP-Cy5.5

Applications FC, IF
Reactivities Human
Conjugation PerCP-Cy5.5

Visfatin (NAMPT) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure E.coli derived recombinant Human Visfatin.

Visfatin (NAMPT) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure E.coli derived recombinant Human Visfatin.

Aldehyde Oxidase (AOX1) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human AOX1

CD203c Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Dog, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset, Dog (100%); Bovine, Horse, Pig (95%); Panda, Bat (84%).

CD203c Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Orang-Utan
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from C-Terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan (100%); Chimpanzee (95%); Gibbon, Hamster (89%); Monkey (84%).

CD203c Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Monkey (100%); Gibbon (95%); Rat, Rabbit, Pig (80%).

CD203c Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Human
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Orangutan, Marmoset (95%); Horse, Rabbit (84%).

Rabbit polyclonal anti-Visfatin antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant human Visfatin

Rabbit polyclonal anti-Visfatin antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen E. coli expressed recombinant rat Visfatin

Mouse Anti-Human CD38 Purified (100 ug)

Reactivities Human
Conjugation Unconjugated

Goat Anti-CD38 (aa226-237) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EVHNLQPEKVQT, from the internal region of the protein sequence according to NP_001766.2.

Biotinylated Anti-Human Visfatin Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Visfatin

Goat Polyclonal ENPP-1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human ENPP1 protein (between residues 900-925) [UniProt P22413]

Rabbit Polyclonal PBEF/Visfatin/NAMPT Antibody

Applications WB
Reactivities Chicken, Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen A portion of amino acid 30-80 of human NAMPT/Visfatin was used as the immunogen.

Rabbit Polyclonal Anti-CD38 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen CD38 antibody was raised against synthetic 15 amino acid peptide from C-Terminus of human CD38. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (93%); Marmoset (80%).

Rabbit Polyclonal Anti-CD38 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CD38 antibody was raised against synthetic 16 amino acid peptide from internal region of human CD38. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla (94%); Marmoset (88%).

Rabbit anti CD38 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CD38 mouse monoclonal antibody,clone OTI1C9

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CD38 mouse monoclonal antibody, clone OTI1H9

Applications FC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CD38 mouse monoclonal antibody, clone OTI8D5

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CD38 mouse monoclonal antibody, clone OTI11C3

Applications FC
Reactivities Human
Conjugation Unconjugated

Anti-AOX1 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1

Anti-AOX1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1

Anti-NAMPT Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human nicotinamide phosphoribosyltransferase

Anti-NAMPT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human nicotinamide phosphoribosyltransferase

Anti-ENPP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 850-864 amino acids of Human ectonucleotide pyrophosphatase/phosphodiesterase 3

Anti-ENPP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 850-864 amino acids of Human ectonucleotide pyrophosphatase/phosphodiesterase 3

Rabbit Polyclonal Anti-CD38 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CD38

NADK Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

CD38 mouse monoclonal antibody,clone OTI1C9

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CD38 mouse monoclonal antibody,clone OTI1C9

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated