Rabbit anti-GABARAP Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GABARAP |
Rabbit anti-GABARAP Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GABARAP |
Rabbit Polyclonal GABARAP Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GABARAP antibody was raised against a 19 amino acid peptide near the amino terminus of human GABARAP. |
Rabbit Polyclonal GABARAP Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region of the human GABARAP protein (within residues 50-117). [Swiss-Prot O95166] |
GABARAP rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal GABARAP Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | N-terminus of GABAa Receptor Associated Protein (Proprietary) |
Rabbit Polyclonal GABARAP Antibody
Applications | IHC |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of the human GABARAP protein (within residues 1-50). [Swiss-Prot O95166] |
Rabbit Polyclonal Anti-GABARAP
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV |
Rabbit Polyclonal Anti-GABARAP
Applications | WB |
Reactivities | Human, Manducasexta |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
GABARAP Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GABARAP |