Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GIPC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GIPC1 antibody: synthetic peptide directed towards the N terminal of human GIPC1. Synthetic peptide located within the following region: SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA

Rabbit Polyclonal antibody to GIPC1 (GIPC PDZ domain containing family, member 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 273 and 333 of GIPC1

GIPC (GIPC1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 51-81 amino acids from the N-terminal region of human GIPC1

Goat Polyclonal Antibody against GIPC1 / NIP

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GAIGDAKVGRY, from the C Terminus of the protein sequence according to NP_005707.1; NP_974197.1; NP_974199.1; NP_974196.1; NP_974198.1; NP_974223.1.

Carrier-free (BSA/glycerol-free) GIPC1 mouse monoclonal antibody,clone OTI4C11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GIPC1 mouse monoclonal antibody,clone OTI5C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GIPC1 mouse monoclonal antibody,clone OTI6A6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GIPC1 mouse monoclonal antibody,clone OTI4C11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GIPC1 mouse monoclonal antibody,clone OTI4C11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GIPC1 mouse monoclonal antibody,clone OTI5C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GIPC1 mouse monoclonal antibody,clone OTI5C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GIPC1 mouse monoclonal antibody,clone OTI6A6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GIPC1 mouse monoclonal antibody,clone OTI6A6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated