Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Monoclonal Antibody against PTPN11 (Clone Y477)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against PTPN6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HTKNKREEKVKKQ, from the internal region (near the C Terminus) of the protein sequence according to NP_536858.1; NP_002822.2. |
Rabbit polyclonal SHP-1 (Phospho-Tyr564) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SHP-1 around the phosphorylation site of tyrosine 564 (D-V-YP-E-N). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-SHP-1 (Tyr536) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-1 around the phosphorylation site of Tyrosine 536 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Ppp3cb Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ppp3cb antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI |
Rabbit Polyclonal Anti-Ppp3cb Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit Polyclonal Phospho-SHP-2 (Tyr542) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-2 around the phosphorylation site of Tyrosine 542 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-SHP-2 (Tyr580) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-2 around the phosphorylation site of Tyrosine 580 |
| Modifications | Phospho-specific |
Rabbit Polyclonal SHP-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-1 |
Rabbit Polyclonal SHP-2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-2 |
Rabbit Polyclonal SHP-2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-2 |
Calcineurin A (PPP3CA) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH |
Calcineurin A (PPP3CA) sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A purified peptide conjugated to KLH |
SHP2 (PTPN11) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide mapping at the C-terminal of Human SHP-2 |
Rabbit polyclonal anti-Calcineurin A antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 267 of human Calcineurin A |
Anti-PTPN11 (Phospho-Tyr542) Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 542 (H-E-Y(p)-T-N) derived from Human SHP-2. |
| Modifications | Phospho-specific |
SHP2 (PTPN11) (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | 14 amino acid peptide sequence near the carboxy terminus of human SHP2 |
Goat Polyclonal Antibody against SHP2 / PTPN11
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YENVGLMQQQKSFR, from the C Terminus of the protein sequence according to NP_002825.3. |
Goat Polyclonal Antibody against PTPN6 (Internal Region)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KASRTSSKHKEE, from the internal region of the protein sequence according to NP_536858.1; NP_002822.2. |
Rabbit Polyclonal SHP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SHP2 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human SHP2. |
Rabbit polyclonal Anti-PPP3R1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP3R1 antibody: synthetic peptide directed towards the N terminal of human PPP3R1. Synthetic peptide located within the following region: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ |
Rabbit Polyclonal Anti-PPP3CA
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the N terminal of human PPP3CA. Synthetic peptide located within the following region: MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHL |
Rabbit Polyclonal Anti-PPP3CA
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the middle region of human PPP3CA. Synthetic peptide located within the following region: LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINE |
Anti-PTPN6 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 244-515 amino acids of human protein tyrosine phosphatase, non-receptor type 6 |
Anti-PTPN11 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human protein tyrosine phosphatase, non-receptor type 11protein tyrosine phosphatase, non-receptor type 11 |
Active filters
Isotypes
- IgG
Families
- Phosphatase
Pathways
- Natural killer cell mediated cytotoxicity