Rabbit Polyclonal Anti-DUSP10 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DUSP10 |
Rabbit Polyclonal Anti-DUSP10 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DUSP10 |
Rabbit polyclonal DUSP10 antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DUSP10. |
Goat Polyclonal Antibody against DUSP10 / MKP5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CRILTPKLMGVETVV, from the C Terminus of the protein sequence according to NP_009138.1; NP_653329.1; NP_653330.1. |
Rabbit Polyclonal Anti-DUSP10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DUSP10 antibody: synthetic peptide directed towards the N terminal of human DUSP10. Synthetic peptide located within the following region: MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFE |
Carrier-free (BSA/glycerol-free) DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DUSP10 mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DUSP10 mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
DUSP10 mouse monoclonal antibody, clone OTI2H1 (formerly 2H1), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
DUSP10 mouse monoclonal antibody, clone OTI2H1 (formerly 2H1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
DUSP10 mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |