Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-INPP5K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF

Rabbit Polyclonal Anti-SYNJ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the N terminal of human SYNJ1. Synthetic peptide located within the following region: IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR

Rabbit Polyclonal Anti-SYNJ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the middle region of human SYNJ1. Synthetic peptide located within the following region: PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP

Rabbit Polyclonal Anti-SYNJ2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYNJ2 antibody: synthetic peptide directed towards the N terminal of human SYNJ2. Synthetic peptide located within the following region: SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL

Rabbit Polyclonal Anti-MTMR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTMR1 antibody: synthetic peptide directed towards the C terminal of human MTMR1. Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY

Rabbit polyclonal antibody to PSPH (phosphoserine phosphatase)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 175 of PSPH (Uniprot ID#P78330)

MTMR6 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 114-143 amino acids from the N-terminal region of Human MTMR6.

Goat Anti-PSPH Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-RQQVKDNAKWYITD, from the C-Terminus of the protein sequence according to NP_004568.2.

Rabbit polyclonal antibody to Myotubularin related protein 2 (myotubularin related protein 2)

Applications IHC, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 221 and 527 of MTMR2 (Uniprot ID#Q13614)

Rabbit Polyclonal Anti-MTMR7 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MTMR7 Antibody is: synthetic peptide directed towards the C-terminal region of Human MTMR7. Synthetic peptide located within the following region: NLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFL

Rabbit polyclonal Anti-PSPH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSPH antibody: synthetic peptide directed towards the middle region of human PSPH. Synthetic peptide located within the following region: PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA

Rabbit polyclonal Anti-PSPH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSPH antibody: synthetic peptide directed towards the middle region of human PSPH. Synthetic peptide located within the following region: IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE

Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-MTMR7 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MTMR7

INPP5K Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

MTMR6 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated