Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to Inhibin beta A (inhibin, beta A)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 362 and 426 of Inhibin beta A

Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014)

Rabbit Anti-Periostin C-terminal Antibody

Applications WB
Reactivities Chicken, Human, Mouse
Conjugation Unconjugated
Immunogen Bacterial fusion protein equivalent to a 188-amino acid polypeptide from the C-terminal region of mouse periostin which is comprised of six small alternatively-spliced exons

Rabbit Anti-Periostin pan Antibody

Applications WB
Reactivities Chicken, Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the fasciclin domain 1 of mouse periostin

Rabbit Polyclonal Antibody against VEGFA

Applications WB
Reactivities Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692]

Rabbit Polyclonal anti-CALR Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep
Conjugation Unconjugated
Immunogen Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH

ILEI / FAM3C Rabbit Polyclonal (aa40-80) Antibody

Applications IHC
Reactivities Bovine, Chimpanzee, Chicken, Human, Monkey, Mouse, Opossum, Rat, Dog, Pufferfish
Conjugation Unconjugated
Immunogen ILEI / FAM3C antibody was raised against synthetic peptide from human FAM3C.

Anti-IGFBP-5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Goat, Hamster, Horse, Human, Monkey, Pig, Rabbit
Conjugation Unconjugated
Immunogen IGFBP5 antibody was raised against human IGFBP5 amino acids 192-206 (CRRHMEASLQELKAS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bat, Bovine, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Mouse, Rat, Opossum, Chicken (93%); Marmoset (87%).

Rabbit Polyclonal Anti-ApoA4 Antibody

Applications WB
Reactivities Chicken, Human
Conjugation Unconjugated
Immunogen ApoA4 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of chicken ApoA4.

Rabbit Polyclonal Apolipoprotein E R2/ApoE R2 Antibody

Applications WB
Reactivities Human, Mouse, Chicken
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human ApoER2 protein sequence (between residues 863-963). [UniProt# Q14114]

Neuropeptide Y (NPY) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Chicken, Feline, Guinea Pig, Human, Rat, Zebrafish
Conjugation Unconjugated

Rabbit Polyclonal antibody to ADCK1 (aarF domain containing kinase 1)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 45 and 213 of ADCK1

WNT7A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%).

Rabbit Polyclonal ApoA1 Antibody

Applications WB
Reactivities Chicken, Human
Conjugation Unconjugated
Immunogen ApoA1 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ApoA1.

Rabbit polyclonal NTN1 Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NTN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 568-596 amino acids from the C-terminal region of human NTN1.

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Chicken, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT

Rabbit Polyclonal Apolipoprotein E R2/ApoE R2 Antibody

Applications WB
Reactivities Human, Mouse, Bovine, Chicken
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human ApoER2 protein sequence (between residues 800-900). [UniProt# Q14114]

Mouse anti Laminin Monoclonal Antibody

Reactivities Bovine, Chicken, Human, Rat
Conjugation Unconjugated

WNT11 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT11 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT11. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus (100%); Opossum, Stickleback (87%); Xenopus, Zebrafish (80%).

Rabbit polyclonal anti-Alpha-Amylase antibody

Applications WB
Reactivities Chicken, Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 273 of rat a-Amylase

Rabbit polyclonal anti-SLIT-2 antibody

Applications WB
Reactivities Chicken, Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding aa 484-500 of Human SLIT-2 protein.

Mouse Monoclonal anti-TIMP-2 Antibody

Applications WB
Reactivities Human, Mouse, Rabbit, Chicken, Zebrafish
Conjugation Unconjugated

Rabbit Polyclonal Anti-WNT1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT1 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Chicken (94%); Lizard (88%); Zebrafish (81%).

Rabbit Polyclonal Anti-WNT2 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT2 / IRP antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset (100%); Galago, Mouse, Rat, Ferret, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Cat, Bat, Rabbit, Pig, Opossum, Guinea pig, Turkey, Chicken, Armadillo, Platypus (93%); Horse (87%).

Rabbit Polyclonal Anti-LOXL2 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen LOXL2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human LOXL2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Dog, Bovine, Bat, Elephant, Panda, Horse, Rabbit (100%); Mouse, Rat, Opossum, Turkey, Chicken, Platypus (93%); Xenopus, Pufferfish, Zebrafish, Stickleback (87%).