Primary Antibodies

Jump to Filters
View as table Download
SYNPR Guinea Pig Polyclonal Antibody
BP5104

USD 375.00

2 Weeks

SYNPR guinea pig polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human, Mouse, Rat
Immunogen Synthetic C-terminal peptide CHSSGQRYLSDPMEKHS (corresponding to a part of the cytoplasmic carboxy terminus) conjugated to KLH.
SYNPR Rabbit Polyclonal Antibody
TA342623

USD 375.00

5 Days

Rabbit Polyclonal Anti-SYNPR Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Synpr antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV