Rabbit polyclonal anti-PE2R3 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PE2R3. |
Rabbit polyclonal anti-PE2R3 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PE2R3. |
Rabbit Polyclonal Anti-Ppp3cb Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal anti-Calcineurin A antibody
Applications | WB |
Reactivities | Bovine, Hamster, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 267 of human Calcineurin A |
PTGER3 (Cytoplasmic Domain) rabbit polyclonal antibody, Immunoaffinity purified
Applications | IHC |
Reactivities | Human, Bovine, Pig, Horse, Monkey (Predicted: Rat, Bat, Rabbit) |
Conjugation | Unconjugated |
Immunogen | Synthetic 16 amino acid peptide from 1st cytoplasmic domain of human PTGER3 / EP3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Bovine, Horse, Pig (100%); Gorilla, Rat, Elephant, Bat, Rabbit (94%); Mouse, Panda (88%). |
Carrier-free (BSA/glycerol-free) PPP3CB mouse monoclonal antibody,clone OTI2E4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPP3CB mouse monoclonal antibody,clone OTI2E4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPP3CB mouse monoclonal antibody,clone OTI2E4, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PPP3CB mouse monoclonal antibody,clone OTI2E4, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PPP3CB mouse monoclonal antibody,clone OTI2E4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |