SOX10 mouse monoclonal antibody, clone 1E6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
SOX10 mouse monoclonal antibody, clone 1E6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-SOX10 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SOX10 Antibody: synthetic peptide directed towards the middle region of human SOX10. Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT |
Rabbit Polyclonal Anti-SOX10 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SOX10 antibody was raised against a peptide corresponding to 18 amino acids near the amino terminus of human SOX10. |