Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Rabbit Polyclonal antibody to MGAT3 (mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 260 and 525 of MGAT3 (Uniprot ID#Q09327) |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
Rabbit Polyclonal antibody to ABO (ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase))
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 95 and 299 of ABO |
Goat Anti-cardiolipin synthase 1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSALGSALDPLADK, from the internal region of the protein sequence according to NP_061968.1; NP_001120930.1. |
Rabbit polyclonal anti-B4GALNT1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human B4GALNT1. |
Rabbit polyclonal anti-B4GALT1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human B4GALT1. |
Rabbit polyclonal CYP1A2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2. |
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Rabbit polyclonal EXT2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EXT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-209 amino acids from the Central region of human EXT2. |
Rabbit anti-ATP6AP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATP6AP1 |
ABO Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABO |
UGT1A9 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A9 |
GGT1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GGT1 |
Rabbit anti-UGT2B7 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT2B7 |
Rabbit anti-HSD3B2 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HSD3B2 |
Rabbit Polyclonal Anti-ST3GAL5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ST3GAL5 antibody: synthetic peptide directed towards the N terminal of human ST3GAL5. Synthetic peptide located within the following region: DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS |
Rabbit Polyclonal Anti-PIGF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIGF antibody: synthetic peptide directed towards the N terminal of human PIGF. Synthetic peptide located within the following region: MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF |
Rabbit Polyclonal Anti-PIGK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIGK antibody: synthetic peptide directed towards the N terminal of human PIGK. Synthetic peptide located within the following region: SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD |
Rabbit Polyclonal Anti-DHODH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHODH antibody: synthetic peptide directed towards the N terminal of human DHODH. Synthetic peptide located within the following region: FGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLR |
Rabbit Polyclonal Anti-DHODH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHODH antibody: synthetic peptide directed towards the middle region of human DHODH. Synthetic peptide located within the following region: NLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL |
Rabbit Polyclonal Anti-GALNT9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GALNT9 antibody is: synthetic peptide directed towards the C-terminal region of Human GALNT9. Synthetic peptide located within the following region: DFGDVSERLALRQRLKCRSFKWYLENVYPEMRVYNNTLTYGEVRNSKASA |
Rabbit Polyclonal Anti-Cytochrome P450 2U1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cytochrome P450 2U1 Antibody: A synthesized peptide derived from human Cytochrome P450 2U1 |
CD38 mouse monoclonal antibody, clone T16, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
PIGN (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 213-243aa) of human PIGN . |
Goat Polyclonal Antibody against GCNT3 (aa 410 to 422)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NKFDPKVDDNALQ, from the internal region (near C terminus) of the protein sequence according to NP_004742.1. |
Goat Polyclonal Antibody against B3GNT2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKHKGFRTFDIE, from the internal region of the protein sequence according to NP_006568.2. |
Rabbit polyclonal antibody to GAL3ST1 (galactose-3-O-sulfotransferase 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 412 of GAL3ST1 (Uniprot ID#Q99999) |
Rabbit Polyclonal antibody to GALNT7 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 (GalNAc-T7))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 24 and 515 of GALNT7 (Uniprot ID#Q86SF2) |
Rabbit polyclonal anti-BST1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BST1. |
Rabbit polyclonal anti-GUSB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GUSB. |
Rabbit polyclonal anti-NDUFA4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4. |
Rabbit polyclonal anti-PTGIS antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PTGIS. |
Active filters
Families
- Transmembrane
Pathways
- Metabolic pathways
Filter by
Target Symbol
- CYP1A2 (57)
- RPN1 (51)
- CYP2J2 (39)
- ALDH3A2 (36)
- COX6A1 (36)
- ANPEP (34)
- CD38 (34)
- CYP2A6 (33)
- PON3 (33)
- CYP2E1 (25)
- ACSL5 (23)
- DDOST (21)
- NDUFA4L2 (21)
- BST1 (17)
- B3GNT2 (16)
- GALNT10 (15)
- NDUFB3 (15)
- TYR (15)
- COX6C (12)
- HSD17B2 (12)
- NT5E (12)
- PTGS1 (12)
- COX4I1 (11)
- SMPD1 (11)
- COMT (10)
- CYP3A4 (10)
- GCNT3 (10)
- PLPP1 (10)
- B4GALT3 (8)
- ENPP3 (8)
- FUT4 (8)
- RPN2 (8)
- B3GAT1 (7)
- DBH (7)
- HSD17B3 (7)
- PLA2G2A (7)
- ALDH6A1 (6)
- DCT (6)
- DHODH (6)
- G6PC1 (6)
- SGMS2 (6)
- SPTLC1 (6)
- TPO (6)
- B4GALT4 (5)
- CYP2A7 (5)
- DGAT1 (5)
- GGT1 (5)
- GPAT4 (5)
- HSD11B1 (5)
- MAOB (5)
- NAT2 (5)
- A4GALT (4)
- ACMSD (4)
- ACSL1 (4)
- ACSL4 (4)
- AGPAT4 (4)
- ALG11 (4)
- ATP6AP1 (4)
- B4GALT2 (4)
- COX10 (4)
- CYP2A13 (4)
- CYP3A5 (4)
- CYP3A7 (4)
- CYP4A11 (4)
- CYP8B1 (4)
- DEGS1 (4)
- GUSB (4)
- HSD3B1 (4)
- NDUFA4 (4)
- UGT1A6 (4)
- UGT8 (4)
- ABO (3)
- ACER1 (3)
- ACSL6 (3)
- AGPAT2 (3)
- AGPAT3 (3)
- ALG6 (3)
- AOC2 (3)
- AOC3 (3)
- B3GALT1 (3)
- B4GALNT1 (3)
- CDS1 (3)
- CHST2 (3)
- COX15 (3)
- COX4I2 (3)
- CSGALNACT1 (3)
- CSGALNACT2 (3)
- CYP2C8 (3)
- CYP2U1 (3)
- CYP3A43 (3)
- DEGS2 (3)
- DGAT2 (3)
- DGKE (3)
- DHCR24 (3)
- DPAGT1 (3)
- EXT1 (3)
- EXTL3 (3)
- FUT1 (3)
- FUT8 (3)
- GALNT6 (3)
Reactivities
- Human (1071)
- Mouse (377)
- Rat (353)
- Dog (41)
- Monkey (39)
- Bovine (15)
- Pig (10)
- Cow (9)
- Primate (6)
- Gibbon (5)
- Gorilla (4)
- Orang-Utan (4)
- Zebrafish (4)
- Chicken (3)
- Horse (3)
- Rabbit (3)
- Rhesus Monkey (3)
- Chimpanzee (2)
- Goat (2)
- Hamster (2)
- Sheep (2)
- Xenopus (2)
- Baboon (1)
- Drosophila (1)
- Guinea Pig (1)
- Marmoset (1)
- Porcine (1)
- X. tropicalis (1)