Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Anti-PPAP2C Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-269 amino acids of human phosphatidic acid phosphatase type 2C |
Rabbit Polyclonal ASAH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human ASAH2. |
Goat Anti-UGT8 Antibody
| Applications | WB |
| Reactivities | Expected from seq similarity: Human, Rat, Dog, Cow |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NGKYKRNGHIK, from the internal region of the protein sequence according to NP_003351.2. |
Rabbit Polyclonal Anti-Smpd4 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Smpd4 antibody is: synthetic peptide directed towards the middle region of Rat Smpd4. Synthetic peptide located within the following region: LHSPAQPSLQALHAYQESFMPTEEHVLVVRLLLKHLHAFANSLKPDQASP |
Anti-PPAP2A Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
Rabbit Polyclonal Anti-DEGS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DEGS1 |
Active filters
Reactivities
- Rat
Families
- Transmembrane
Pathways
- Sphingolipid metabolism