Primary Antibodies

View as table Download

Mouse Monoclonal Anti-VISTA Antibody [4C4]

Applications ELISA, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-VISTA Antibody [6D2]

Applications ELISA, FC, IF, IHC
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-VISTA Antibody [8E11]

Applications ELISA, FC, IF, IHC
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-VISTA Antibody [9E4]

Applications ELISA, FC, IF, IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-C10orf54 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C10orf54 antibody: synthetic peptide directed towards the N terminal of human C10orf54. Synthetic peptide located within the following region: TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE

Carrier-free (BSA/glycerol-free) C10orf54 mouse monoclonal antibody,clone OTI7E9

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C10orf54 mouse monoclonal antibody,clone OTI6E5

Applications FC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C10orf54 mouse monoclonal antibody,clone OTI8B8

Applications FC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C10orf54 mouse monoclonal antibody,clone OTI7A6D5

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C10orf54 mouse monoclonal antibody,clone OTI1D10C1

Applications WB
Reactivities Human
Conjugation Unconjugated

C10orf54 mouse monoclonal antibody,clone OTI6E5

Applications FC
Reactivities Human
Conjugation Unconjugated

C10orf54 mouse monoclonal antibody,clone OTI6E5

Applications FC
Reactivities Human
Conjugation Unconjugated

C10orf54 mouse monoclonal antibody,clone OTI8B8

Applications FC
Reactivities Human
Conjugation Unconjugated

C10orf54 mouse monoclonal antibody,clone OTI8B8

Applications FC
Reactivities Human
Conjugation Unconjugated

VISTA(C10ORF54) mouse monoclonal antibody,clone UMAB271

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) VISTA(C10ORF54) mouse monoclonal antibody,clone UMAB271

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

VISTA(C10ORF54) mouse monoclonal antibody,clone UMAB272

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) VISTA(C10ORF54) mouse monoclonal antibody,clone UMAB272

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

VISTA(C10ORF54) mouse monoclonal antibody,clone UMAB271

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

VISTA(C10ORF54) mouse monoclonal antibody,clone UMAB272

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated