Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PYY Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PYY

Rabbit Polyclonal Anti-PYY Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYY antibody: synthetic peptide directed towards the middle region of human PYY. Synthetic peptide located within the following region: APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED

Rabbit Polyclonal Anti-PYY Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PYY