Rabbit Polyclonal Anti-VTI1a Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VTI1a antibody was raised against a 19 amino acid peptide near the center of human VTI1a. |
Rabbit Polyclonal Anti-VTI1a Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VTI1a antibody was raised against a 19 amino acid peptide near the center of human VTI1a. |
Rabbit polyclonal anti-VTI1A antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human VTI1A. |
VTI1A (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human VTI1A |
Rabbit Polyclonal Anti-VTI1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VTI1A antibody: synthetic peptide directed towards the N terminal of human VTI1A. Synthetic peptide located within the following region: SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL |
Carrier-free (BSA/glycerol-free) VTI1A mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) VTI1A mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
VTI1A mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
VTI1A mouse monoclonal antibody,clone 1E3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
VTI1A mouse monoclonal antibody,clone 1E3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
VTI1A mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
VTI1A mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
VTI1A mouse monoclonal antibody,clone 1F4, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
VTI1A mouse monoclonal antibody,clone 1F4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
VTI1A mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |