Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal CLDN1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CLDN1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human CLDN1. The immunogen is located within the last 50 amino acids of CLDN1. |
Rabbit polyclonal anti-E-Selectin antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 584 of human E-Selectin |
HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRA |
Rabbit anti-CD99 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD99 |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
CLDN3 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human CLDN3 |
Rabbit anti-ITGAL Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ITGAL |
Rabbit anti-PVRL2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PVRL2 |
Rabbit Polyclonal Anti-CLDN23 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN23 antibody: synthetic peptide directed towards the C terminal of human CLDN23. Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE |
Rabbit polyclonal SELL Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SELL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 346-372 amino acids from the C-terminal region of human SELL. |
F11R Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human F11R |
SELL Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SELL |
Rabbit anti-SELE Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SELE |
Rabbit anti-PVR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PVR |
Rabbit anti-CD22 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD22 |
Rabbit Polyclonal Anti-Claudin 5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5 |
Rabbit Polyclonal Anti-CDH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDH2 Antibody: A synthesized peptide derived from human CDH2 |
Goat Polyclonal Anti-CDH1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 750 to 850 of human CDH1 produced in E. coli. |
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Rabbit Polyclonal antibody to Integrin alpha 6 (integrin, alpha 6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 565 and 872 of Integrin alpha 6 (Uniprot ID#P23229) |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-CDH15 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CDH15. |
Rabbit polyclonal Claudin 7 (Ab-210) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | he antiserum was produced against synthesized non-phosphopeptide derived from human Claudin 7 around the phosphorylation site of tyrosine 210 (S-K-E-YP-V). |
Rabbit polyclonal anti-HLA-DOB antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HLA-DOB. |
Rabbit polyclonal CDH4 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDH4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 175-203 amino acids from the N-terminal region of human CDH4. |
Rabbit polyclonal CDH3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CDH3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 114-142 amino acids from the N-terminal region of human CDH3. |
Rabbit Polyclonal VE-Cadherin (Tyr731) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VE-Cadherin around the phosphorylation site of Tyrosine 731 |
| Modifications | Phospho-specific |
HLA-DRB3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRB3 |
SELPLG Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SELPLG |
Rabbit anti-MPZ Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MPZ |
Rabbit anti-CADM1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CADM1 |
CLDN7 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLDN7 |
PVRL1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PVRL1 |
CLDN1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLDN1 |
Rabbit anti-CD58 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD58 |
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-PVRL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PVRL3 antibody: synthetic peptide directed towards the N terminal of human PVRL3. Synthetic peptide located within the following region: SGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAI |
Active filters
Isotypes
- IgG
Pathways
- Cell adhesion molecules (CAMs)
Filter by
Category
Target Symbol
- CDH1 (15)
- CLDN7 (11)
- ICAM1 (11)
- PECAM1 (11)
- CD274 (10)
- CDH5 (9)
- CLDN1 (9)
- CD22 (8)
- CD40 (8)
- CLDN11 (8)
- CLDN5 (8)
- ITGAV (8)
- CLDN3 (7)
- CLDN4 (7)
- VCAM1 (7)
- CDH2 (6)
- CLDN10 (6)
- ITGA4 (6)
- ITGB1 (6)
- ITGB2 (6)
- PTPRC (6)
- CADM3 (5)
- CD4 (5)
- CD99 (5)
- ITGA6 (5)
- NFASC (5)
- SDC1 (5)
- CD226 (4)
- CD40LG (4)
- CD8A (4)
- CD8B (4)
- CLDN14 (4)
- CLDN19 (4)
- NCAM1 (4)
- NECTIN2 (4)
- PDCD1 (4)
- PTPRM (4)
- SELE (4)
- SELP (4)
- SELPLG (4)
- CADM1 (3)
- CD34 (3)
- CDH3 (3)
- CLDN18 (3)
- CLDN6 (3)
- CLDN8 (3)
- CNTN1 (3)
- F11R (3)
- GLG1 (3)
- ICOSLG (3)
- ITGAL (3)
- ITGAM (3)
- JAM2 (3)
- MPZ (3)
- NECTIN1 (3)
- NECTIN3 (3)
- SELL (3)
- ALCAM (2)
- CD2 (2)
- CD58 (2)
- CD6 (2)
- CD80 (2)
- CD86 (2)
- CDH15 (2)
- CDH4 (2)
- CLDN15 (2)
- CLDN16 (2)
- CLDN2 (2)
- CLDN23 (2)
- HLA-A (2)
- HLA-DMA (2)
- HLA-DOB (2)
- HLA-DPA1 (2)
- HLA-DQA2 (2)
- HLA-DRA (2)
- HLA-DRB3 (2)
- HLA-F (2)
- ICAM2 (2)
- ICOS (2)
- NCAM2 (2)
- NEGR1 (2)
- NLGN4X (2)
- NRCAM (2)
- PDCD1LG2 (2)
- PVR (2)
- SDC3 (2)
- SDC4 (2)
- SMURF2 (2)
- CD276 (1)
- CD28 (1)
- CLDN17 (1)
- CLDN9 (1)
- CNTN2 (1)
- CNTNAP1 (1)
- HLA-B (1)
- HLA-DMB (1)
- HLA-DOA (1)
- HLA-DPB1 (1)
- HLA-DQB1 (1)
- HLA-DRB1 (1)